Integrin alpha 3A antibody
Catalogue Number: 10R-8071-FIT
| Manufacturer: | Biosynth |
| Type: | Monoclonal Primary Antibody - Unconjugated |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Mouse |
| Clone: | 158A3 |
| Isotype: | IgG2a |
| Immunogen: | Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen. |
| Application: | WB, IHC-Fr, IHC |
Additional Text
Short Description
Mouse monoclonal Integrin alpha 3A antibody
Antibody Clonality
Monoclonal
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations