GAN (Gigaxonin, FLJ38059, GAN1, Kelch-like Protein 16, KLHL16) (MaxLight 490)

Catalogue Number: 127153-ML490-USB

Manufacturer:United States Biological
Physical state:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Type:Monoclonal Primary Antibody - Conjugated
Shipping Condition:Blue Ice
Unit(s): 100 ul
Host name: Mouse
Clone: 4G7
Isotype: IgG2a, kappa
Immunogen: Partial recombinant protein corresponding to aa534-598 of GAN (NP_071324) with GST tag. MW of the GST tag alone is 26kD. AA Sequence: DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP
Application: ICC, IF, WB, FLISA

Description

Description: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Probable cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Controls degradation of TBCB. Controls degradation of MAP1B and MAP1S, and is critical for neuronal maintenance and survival.

Additional Text

Specificity

Recognizes human GAN.

Purification

Protein A purified

Accession Number

NM_022041

Antibody Clonality

Monoclonal