GAN (Gigaxonin, FLJ38059, GAN1, Kelch-like Protein 16, KLHL16) (MaxLight 650)
Catalogue Number: 127153-ML650-USB
| Manufacturer: | United States Biological |
| Physical state: | Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650. |
| Type: | Monoclonal Primary Antibody - Conjugated |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ul |
| Host name: | Mouse |
| Clone: | 4G7 |
| Isotype: | IgG2a, kappa |
| Immunogen: | Partial recombinant protein corresponding to aa534-598 of GAN (NP_071324) with GST tag. MW of the GST tag alone is 26kD. AA Sequence: DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP |
| Application: | ICC, IF, WB, FLISA |
Description
Description: MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Probable cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Controls degradation of TBCB. Controls degradation of MAP1B and MAP1S, and is critical for neuronal maintenance and survival.
Additional Text
Specificity
Recognizes human GAN.
Purification
Protein A purified
Accession Number
NM_022041
Antibody Clonality
Monoclonal
127153-ML650 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations