Catalogue Number: 298226-USB
| Manufacturer: | United States Biological |
| Physical state: | Supplied as a lyophilized powder in PBS, pH 7.4. No preservative added. Reconstitute with sterile ddH2O. |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | BDE2|HHM|osteostatin|parathyroid hormone-like hormone preproprotein|parathyroid hormone-like related protein|parathyroid hormone-related protein|PLP|PTHR|PTH-related protein|PTHRP|PTH-rP |
| Shipping Condition: | Blue Ice |
| Unit(s): | 10 ug, 100 ug |
| Host name: | Goat |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Synthetic peptide corresponding to aa53-86, KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP, of human PTHrP, KLH conjugated. |
| Application: | RIA |
PTHLH
5744
P12272
Recognizes human Parathyroid Hormone-Related Peptide.
Protein G purified
Polyclonal