Catalogue Number: 39-2011-ABO
Manufacturer: | Abeomics |
Shelf Life: | 12 months |
Physical state: | Lyophilized |
Type: | Polyclonal Primary Antibody - Unconjugated |
Alias: | Protein Wnt-7a; WNT7A |
Shipping Condition: | Blue Ice |
Unit(s): | 100 ug |
Host name: | Rabbit |
Clone: | |
Isotype: | IgG |
Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence. |
Application: | IHC-P, WB |
Description: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.
WNT7A
7476
O00755
Affinity Purified
Polyclonal
Western blot : 0.1-0.5µg/ml; Immunohistochemistry(Paraffin-embedded Section) : 0.5-1µg/ml