Catalogue Number: AB02169-2.0-BT-ABA
| Manufacturer: | Vector Laboratories, Inc (ABA) |
| Type: | Recombinant Monoclonal |
| Alias: | N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 1 mg |
| Host name: | Mouse |
| Clone: | N323B/20 |
| Isotype: | IgG2a |
| Immunogen: | This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B. |
| Application: | ICC, WB, IHC |
ABCC9
Purified
Recombinant Monoclonal
Q63563
25560
Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For longer storage, aliquot and store at -20⁰C.
This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot.