Anti-SUR2B [N323B/20]

Catalogue Number: AB02169-2.0-BT-ABA

Manufacturer:Vector Laboratories, Inc (ABA)
Type:Recombinant Monoclonal
Alias:N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2
Shipping Condition:Blue Ice
Unit(s): 1 mg
Host name: Mouse
Clone: N323B/20
Isotype: IgG2a
Immunogen: This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
Application: ICC, WB, IHC

Additional Text

Gene Name

ABCC9

Purification

Purified

Antibody Clonality

Recombinant Monoclonal

Uniprot ID

Q63563

Gene ID

25560

Storage Note

Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For longer storage, aliquot and store at -20⁰C.

Application Notes

This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot.