Anti-HIF-1-Alpha Picoband Antibody
Catalogue Number: ABO11944-ABG
ABO11944 Image
ABO11944 Image
ABO11944 Image
ABO11944 Image
ABO11944 Image
ABO11944 Image
Anti- HIF 1 alpha Picoband antibody, ABO11944, Western blottingAll lanes: Anti HIF 1 alpha (ABO11944) at 0.5ug/mlWB: Recombinant Human HIF 1 alpha Protein 0.5ngPredicted bind size: 36KDObserved bind size: 36KD
ABO11944 Image
Anti- HIF 1 alpha Picoband antibody, ABO11944, Western blottingAll lanes: Anti HIF 1 alpha (ABO11944) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SHG Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 93KDObserved bind size: 120KD
ABO11944 Image
Anti- HIF 1 alpha Picoband antibody, ABO11944,IHC(P)IHC(P): Mouse Intestine Tissue
ABO11944 Image
Anti- HIF 1 alpha Picoband antibody, ABO11944,IHC(P)IHC(P): Rat Intestine Tissue
ABO11944 Image
Anti- HIF 1 alpha Picoband antibody, ABO11944,IHC(P)IHC(P): Human Intestinal Cancer Tissue
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 92670 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids. |
| Application: | IHC-P, WB, IHC |
Description
Description: Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha(HIF1A) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Additional Text
Gene ID
3091
Uniprot ID
Q16665
Molecular Weight
92670
Concentration
500 ug/ml
Purification
Affinity Purified
Specificity
Hypoxia-inducible factor 1-alpha, HIF-1-alpha, HIF1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, bHLHe78, Member of PAS protein 1, PAS domain-containing protein 8, HIF1A, BHLHE78, MOP1, PASD8
Antibody Clonality
Polyclonal
Storage Note
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Gene Name
HIF1A
Preparation
Lyophilized
ABO11944 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations