Catalogue Number: ABO12081-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 26169 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Pulmonary surfactant-associated protein A2, PSP-A, PSPA, SP-A, SP-A2, 35 kDa pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-5, SFTPA2, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids. |
| Application: | IHC-P, WB, IHC-Fr, IHC |
Description: Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Q8IWL1
500 ug/ml
729238
Affinity Purified
Polyclonal
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
SFTPA2
26169
Lyophilized