Anti-SOD2 Picoband Antibody
Catalogue Number: ABO12132-ABG
ABO12132 Image
ABO12132 Image
ABO12132 Image
ABO12132 Image
ABO12132 Image
ABO12132 Image
Figure 2. IHC analysis of SOD2 using anti-SOD2 antibody (ABO12132).SOD2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-SOD2 Antibody (ABO12132) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12132 Image
Figure 3. IHC analysis of SOD2 using anti-SOD2 antibody (ABO12132).SOD2 was detected in immunocytochemical section of A549 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-SOD2 Antibody (ABO12132) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12132 Image
Figure 4. IHC analysis of SOD2 using anti-SOD2 antibody (ABO12132).SOD2 was detected in immunocytochemical section of SMMC-7721 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-SOD2 Antibody (ABO12132) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 24750 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Superoxide dismutase [Mn], mitochondrial, 1.15.1.1, SOD2 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids. |
| Application: | ICC, IHC-P, WB, IHC |
Description
Description: Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.
Additional Text
Uniprot ID
P04179
Gene ID
6648
Molecular Weight
24750
Concentration
500 ug/ml
Purification
Affinity Purified
Antibody Clonality
Polyclonal
Storage Note
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Gene Name
SOD2
Preparation
Lyophilized
ABO12132 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations