Anti-CPT1B Picoband Antibody
Catalogue Number: ABO12179-ABG
ABO12179 Image
ABO12179 Image
ABO12179 Image
ABO12179 Image
ABO12179 Image
ABO12179 Image
ABO12179 Image
Figure 2. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in paraffin-embedded section of Mouse Skeletal Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12179 Image
Figure 3. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in paraffin-embedded section of Rat Cardiac Muscle Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12179 Image
Figure 4. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in frozen section of mouse cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12179 Image
Figure 5. IHC analysis of CPT1B using anti-CPT1B antibody (ABO12179).CPT1B was detected in frozen section of rat cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CPT1B Antibody (ABO12179) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 87801 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Carnitine O-palmitoyltransferase 1, muscle isoform, CPT1-M, 2.3.1.21, Carnitine O-palmitoyltransferase I, muscle isoform, CPT I, CPTI-M, Carnitine palmitoyltransferase 1B, Carnitine palmitoyltransferase I-like protein, CPT1B, KIAA1670 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. |
| Application: | IHC-P, WB, IHC-Fr, IHC |
Description
Description: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Additional Text
Uniprot ID
Q92523
Molecular Weight
87801
Concentration
500 ug/ml
Purification
Affinity Purified
Gene ID
1375
Antibody Clonality
Polyclonal
Storage Note
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Gene Name
CPT1B
Preparation
Lyophilized
ABO12179 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations