Catalogue Number: ABO12254-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 39341 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Alpha-2-HS-glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, Alpha-2-HS-glycoprotein chain A, Alpha-2-HS-glycoprotein chain B, AHSG, FETUA |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids. |
| Application: | ELISA, IHC-P, WB, IHC |
Description: Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human;Rat.
P02765
197
500 ug/ml
Affinity Purified
Polyclonal
AHSG
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
39341
Lyophilized