Anti-IDH1 Picoband Antibody
Catalogue Number: ABO12287-ABG
ABO12287 Image
ABO12287 Image
ABO12287 Image
ABO12287 Image
ABO12287 Image
ABO12287 Image
ABO12287 Image
Figure 2. IHC analysis of IDH1 using anti-IDH1 antibody (ABO12287).IDH1 was detected in paraffin-embedded section of Mouse Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody (ABO12287) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12287 Image
Figure 3. IHC analysis of IDH1 using anti-IDH1 antibody (ABO12287).IDH1 was detected in paraffin-embedded section of Rat Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody (ABO12287) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12287 Image
Figure 4. IHC analysis of IDH1 using anti-IDH1 antibody (ABO12287).IDH1 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody (ABO12287) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12287 Image
Figure 5. IHC analysis of IDH1 using anti-IDH1 antibody (ABO12287).IDH1 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody (ABO12287) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 46659 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Isocitrate dehydrogenase [NADP] cytoplasmic, IDH, 1.1.1.42, Cytosolic NADP-isocitrate dehydrogenase, IDP, NADP(+)-specific ICDH, Oxalosuccinate decarboxylase, IDH1, PICD |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid. |
| Application: | ICC, IHC-P, WB, IHC-Fr, IHC |
Description
Description: Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.
Additional Text
Molecular Weight
46659
Concentration
500 ug/ml
Uniprot ID
O75874
Gene ID
3417
Purification
Affinity Purified
Antibody Clonality
Polyclonal
Storage Note
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Gene Name
IDH1
Preparation
Lyophilized
ABO12287 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations