Catalogue Number: ABO12290-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 29570 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Insulin-like growth factor-binding protein 1, IBP-1, IGF-binding protein 1, IGFBP-1, Igfbp1, Igfbp-1 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid. |
| Application: | ELISA, WB |
Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse;Rat.
P47876
500 ug/ml
Affinity Purified
Polyclonal
16006
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
IGFBP1
29570
Lyophilized