Catalogue Number: ABO12344-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 18709 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Leptin, Obesity factor, LEP, OB |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids. |
| Application: | ELISA, WB |
Description: Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
16846
P41160
18709
500 ug/ml
Affinity Purified
Polyclonal
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Lep
Lyophilized