Catalogue Number: ABO12355-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 80535 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB, Mmp9, Clg4b |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids. |
| Application: | ELISA, IHC-P, WB, IHC |
Description: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, IHC-P, ELISA in Mouse;Rat.
P41245
500 ug/ml
Affinity Purified
17395
Polyclonal
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
MMP9
80535
Lyophilized