Catalogue Number: ABO12396-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 31674 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Insulin-like growth factor-binding protein 3, IBP-3, IGF-binding protein 3, IGFBP-3, IGFBP3, IBP3 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences. |
| Application: | ELISA, IHC-P, WB, IHC |
Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human;Rat.
3486
P17936
31674
500 ug/ml
Affinity Purified
Polyclonal
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
IGFBP3
Lyophilized