Catalogue Number: ABO12397-ABG
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 30570 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Insulin-like growth factor-binding protein 5, IBP-5, IGF-binding protein 5, IGFBP-5, IGFBP5, IBP5 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids. |
| Application: | ELISA, WB |
Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.
P24593
3488
30570
500 ug/ml
Affinity Purified
Polyclonal
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
IGFBP5
Lyophilized