Anti-Adenylosuccinate Lyase Picoband Antibody
Catalogue Number: ABO12877-ABG
ABO12877 Image
ABO12877 Image
ABO12877 Image
ABO12877 Image
ABO12877 Image
Figure 2. IHC analysis of Adenylosuccinate Lyase using anti-Adenylosuccinate Lyase antibody (ABO12877).Adenylosuccinate Lyase was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Adenylosuccinate Lyase Antibody (ABO12877) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
ABO12877 Image
Figure 3. IHC analysis of Adenylosuccinate Lyase using anti-Adenylosuccinate Lyase antibody (ABO12877).Adenylosuccinate Lyase was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Adenylosuccinate Lyase Antibody (ABO12877) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
| Manufacturer: | Abcepta |
| Shelf Life: | 12 months |
| Molecular Weight: | 51658 |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | Argininosuccinate lyase, ASAL, 4.3.2.1, Arginosuccinase, ASL |
| Shipping Condition: | Blue Ice |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN). |
| Application: | IHC-P, WB, IHC |
Description
Description: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Additional Text
Uniprot ID
P04424
Molecular Weight
51658
Gene ID
435
Concentration
500 ug/ml
Purification
Affinity Purified
Antibody Clonality
Polyclonal
Gene Name
ASL
Storage Note
At -20°C for one year. After r°Constitution, at 4°C for one month. It°Can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Preparation
Lyophilized
ABO12877 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations