SUR2A Antibody
Catalogue Number: ASM10265-A700-ABG
ASM10265-A700 Image
ASM10265-A700 Image
ASM10265-A700 Image
Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR2A Monoclonal Antibody, Clone S319A-14 (ASM10265). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody (ASM10265) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) SUR2A Antibody (D) Composite.
ASM10265-A700 Image
Western Blot analysis of Rat Brain Membrane showing detection of ~120 kDa SUR2A protein using Mouse Anti-SUR2A Monoclonal Antibody, Clone S319A-14 (ASM10265). Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 µg). . Load: 10 µg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR2A Monoclonal Antibody (ASM10265) at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~120 kDa.
| Manufacturer: | Abcepta |
| Type: | Primary Antibody |
| Shipping Condition: | Blue Ice |
| Unit(s): | each |
| Host name: | |
| Clone: | |
| Isotype: | IgG2a |
| Immunogen: | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Application: | WB |
Additional Text
Accession Number
NP_001038185.1
Gene Name
ABCC9
Purification
Protein G purified
Uniprot ID
P70170
Gene ID
20928
Storage Note
-20C
ASM10265-A700 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations