SUR1 and SUR2B Antibody
Catalogue Number: ASM10266-A700-ABG
ASM10266-A700 Image
ASM10266-A700 Image
ASM10266-A700 Image
Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-SUR1 and SUR2B Monoclonal Antibody, Clone S323A-31 (ASM10266). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-SUR1 and SUR2B Monoclonal Antibody (ASM10266) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) SUR1 and SUR2B Antibody (D) Composite.
ASM10266-A700 Image
Western Blot analysis of Rat Brain Membrane showing detection of ~174 kDa SUR1/SUR2B protein using Mouse Anti-SUR1/SUR2B Monoclonal Antibody, Clone S323A-31 (ASM10266). Lane 1: MW Ladder. Lane 2: Rat Brain Membrane (10 µg). . Load: 10 µg. Block: 5% milk. Primary Antibody: Mouse Anti-SUR1/SUR2B Monoclonal Antibody (ASM10266) at 1:1000 for 1 hour at RT. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: TMB solution for 10 min at RT. Predicted/Observed Size: ~174 kDa. Other Band(s): ~75 kDa.
| Manufacturer: | Abcepta |
| Type: | Primary Antibody |
| Shipping Condition: | Blue Ice |
| Unit(s): | each |
| Host name: | |
| Clone: | |
| Isotype: | IgG1 |
| Immunogen: | Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B |
| Application: | WB |
Additional Text
Gene Name
ABCC9
Purification
Protein G purified
Accession Number
NP_037172.2
Uniprot ID
Q63563
Storage Note
-20C
Gene ID
25560
ASM10266-A700 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations