Ataxin 1 Antibody
Catalogue Number: ASM10289-A680-ABG
ASM10289-A680 Image
ASM10289-A680 Image
ASM10289-A680 Image
Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (ASM10289). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (ASM10289) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X.
ASM10289-A680 Image
Western Blot analysis of Monkey COS-1 cells transfected with Ataxin- 1 showing detection of ~85 kDa Ataxin 1 protein using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (ASM10289). Lane 1: Molecular Weight Ladder. Lane 2: Monkey COS-1 cells transfected with Ataxin- 1. Load: 15 µg. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (ASM10289) at 1:200 for 16 hours at 4°C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~85 kDa.
| Manufacturer: | Abcepta |
| Type: | Primary Antibody |
| Shipping Condition: | Blue Ice |
| Unit(s): | each |
| Host name: | |
| Clone: | |
| Isotype: | IgG2b |
| Immunogen: | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Application: | WB |
Additional Text
Gene Name
ATXN1
Purification
Protein G purified
Uniprot ID
P54254
Accession Number
NP_001186233.1
Gene ID
20238
Storage Note
-20C
ASM10289-A680 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations