IL21 Receptor antibody
Catalogue Number: GTX13321-GTX
| Manufacturer: | GeneTex |
| Preservative: | 0.1% Sodium azide |
| Molecular Weight: | 59 |
| Physical state: | Liquid |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | CD360,IL21R,NILR,interleukin 21 receptor,IL21-R,IL21 Receptor |
| Shipping Condition: | Blue Ice |
| Unit(s): | 50 ug |
| Host name: | Goat |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor. |
| Application: | ELISA, IHC |
Description
Description: The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010]
Additional Text
Gene Name
IL21R
Gene ID
50615
Uniprot ID
Q9HBE5
Purification
Affinity Purified
Antibody Clonality
Polyclonal
Note
For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption
Concentration
1 mg/ml
Application Notes
ELISA: 1:50,000. IHC: 1:300. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Storage Note
Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
GTX13321 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations