KCNJ1 / ROMK antibody
Catalogue Number: GTX54775-GTX
GTX54775 Image
GTX54775 Image
GTX54775 Image
IHC-Fr analysis of rat kidney tissue using GTX54775 KCNJ1 / ROMK antibody. ?There is strong staining (red) of tubular epithelial cells in distal tubes.?Note that no staining is observed in proximal tubules (arrow).? Counterstain of cell nuclei appears blue. A negative control is shown (right).
GTX54775 Image
WB analysis of rat kidney membrane lysate using GTX54775 KCNJ1 / ROMK antibody preincubated with or without immunogen peptide. Dilution : 1:200
| Manufacturer: | GeneTex |
| Preservative: | 0.025% Sodium azide|0.025% Sodium azide |
| Physical state: | Liquid |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | potassium voltage-gated channel subfamily J member 1 , KAB-1 , Kcnj , Kcnj1_v1 , Kcnj1_v3 , ROMK1 , ROMK2 , ROMK3 , kir1.1 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 ( Intracellular, C-terminus) of rat KCNJ1 (Accession : P35560), (MW: 33 kDa). |
| Application: | ICC, IF, IP, WB, IHC-Fr |
Description
Description: potassium channel involved in K+ secretion in the renal distal nephron [RGD, Feb 2006]
Additional Text
Gene Name
KCNJ1
Concentration
0.8 mg/ml
Purification
Affinity Purified
Gene ID
24521
Antibody Clonality
Polyclonal
Note
For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption
Storage Note
Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
GTX54775 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations