Catalogue Number: GTX54785-GTX
| Manufacturer: | GeneTex |
| Preservative: | 0.025% Sodium azide|0.025% Sodium azide |
| Molecular Weight: | 127 |
| Physical state: | Liquid |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | potassium voltage-gated channel subfamily H member 2 , ERG-1 , ERG1 , H-ERG , HERG , HERG1 , Kv11.1 , LQT2 , SQT1 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 (Intracellular, C-terminus) of human Kv11.1 (HERG) (Accession : Q12809), (MW: 35 kDa.). |
| Application: | ICC, IF, IP, WB, IHC |
Description: This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
Q12809
KCNH2
0.6 mg/ml
Affinity Purified
3757
127
Polyclonal
For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption
Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.