Kv1.2 antibody
Catalogue Number: GTX54835-GTX
GTX54835 Image
GTX54835 Image
GTX54835 Image
GTX54835 Image
IHC-Fr analysis of mouse cerebellum tissue using GTX54835 Kv1.2 antibody. Panel A : KV1.2 (green) Panel B : KV1.1 staining (red) Panel C : Merge of the two images suggests considerable co-localization in the pinceau structures (up-pointing arrows). KV1.1 also appears in blood vessels (down-pointing arrows), where no KV1.2 expression is observed. Dilution : 1:100
GTX54835 Image
WB analysis of rat brain membrane lysate using GTX54835 Kv1.2 antibody preincubated with or without immunogen peptide. Dilution : 1:200
GTX54835 Image
WB analysis of rat heart membrane lysates using GTX54835 Kv1.2 antibody preincubated with or without immunogen peptide. Dilution : 1:200
| Manufacturer: | GeneTex |
| Preservative: | 0.025% Sodium azide|0.025% Sodium azide |
| Molecular Weight: | 57 |
| Physical state: | Liquid |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | potassium voltage-gated channel subfamily A member 2 , BK2 , NGK1 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 (Intracellular, C-terminus) of rat KV1.2 (Accession : P63142). |
| Application: | ICC, IF, WB, IHC-Fr |
Description
Description: delayed-rectifier K+ channel expressed in heart and brain [RGD, Feb 2006]
Additional Text
Gene Name
KCNA2
Concentration
0.8 mg/ml
Uniprot ID
P63142
Purification
Affinity Purified
Molecular Weight
57
Gene ID
25468
Antibody Clonality
Polyclonal
Note
For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption
Storage Note
Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
GTX54835 Datasheet
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations