IHC-plus™ PNPLA3 / Adiponutrin Antibody
Catalogue Number: LS-B15422-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | PNPLA3, ADPN, Acylglycerol O-acyltransferase, C22orf20, Adiponutrin, IPLA2epsilon, DJ796I17.1, IPLA(2)epsilon, IPLA2-epsilon |
| Shipping Condition: | RT |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 377-481 of human PNPLA3 (NP_079501.2). PDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL |
| Application: | IHC-P, WB, IHC |
Additional Text
Gene Name
PNPLA3
Concentration
1.59 mg/ml
Purification
Affinity Purified
Gene ID
80339
Short Description
Adiponutrin antibody LS-B15422 is an unconjugated rabbit polyclonal antibody to Adiponutrin (PNPLA3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 52kDa, while the observed MW by Western blot was 53kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations