IHC-plus™ CA9 / Carbonic Anhydrase IX Antibody
Catalogue Number: LS-B15765-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | CA9, CAIX, Carbonate dehydratase IX, Carbonic anhydrase IX, CA-IX, Carbonic dehydratase, G250, MN, Membrane antigen MN, p54/58N, RCC-associated antigen G250, RCC-associated protein G250, Carbonic anhydrase 9, PMW1, CA IX |
| Shipping Condition: | RT |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 52-151 of human CA9 (NP_001207.2). GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR |
| Application: | IHC-P, WB |
Additional Text
Gene ID
768
Gene Name
CA9
Antigen Type
Recombinant Protein
Purification
Affinity Purified
Short Description
Carbonic Anhydrase IX antibody LS-B15765 is an unconjugated rabbit polyclonal antibody to Carbonic Anhydrase IX (CA9) from human. It is reactive with mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 49kDa, while the observed MW by Western blot was 55kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations