IHC-plus™ DEFA1 / Defensin Alpha 1 Antibody
Catalogue Number: LS-B15772-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | DEFA1, DEFA2, Defensin, alpha 2, HP-1, HP1, Myeloid-related sequence, MRS, DEF1, Defensin, alpha 1, HNP-1, Neutrophil defensin 1 |
| Shipping Condition: | RT |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human DEFA1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Application: | IF, IHC-P, WB, IHC |
Additional Text
Gene Name
DEFA1
Gene ID
1667
Purification
Affinity Purified
Short Description
Defensin Alpha 1 antibody LS-B15772 is an unconjugated rabbit polyclonal antibody to human Defensin Alpha 1 (DEFA1). Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 10kDa, while the observed MW by Western blot was 15kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations