IHC-plus™ ABCB4 / MDR3 Antibody
Catalogue Number: LS-B15778-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | ABCB4, ABC21, ICP3, GBD1, MDR3, MDR2, Multidrug resistance protein 3, Multiple drug resistance 3, P-glycoprotein 3, Pgy2, PGY3, PFIC-3, MDR2/3 |
| Shipping Condition: | RT |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1). MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILE |
| Application: | IHC-P, WB |
Additional Text
Gene Name
ABCB4
Purification
Affinity Purified
Gene ID
5244
Short Description
MDR3 antibody LS-B15778 is an unconjugated rabbit polyclonal antibody to mouse MDR3 (ABCB4). Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 135kDa/140kDa/141kDa, while the observed MW by Western blot was 142kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations