IHC-plus™ CYBA / p22phox Antibody
Catalogue Number: LS-B15780-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | CYBA, Cytochrome b(558) alpha chain, Cytochrome b-245 light chain, Cytochrome b558 subunit alpha, p22 phagocyte B-cytochrome, p22-PHOX, Cytochrome b light chain, p22phox |
| Shipping Condition: | RT |
| Unit(s): | 50 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2). VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV |
| Application: | IF, IHC-P |
Additional Text
Gene Name
CYBA
Gene ID
1535
Short Description
P22phox antibody LS-B15780 is an unconjugated rabbit polyclonal antibody to human p22phox (CYBA). Validated for IF and IHC. Tested on 20 paraffin-embedded human tissues.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 21kDa, while the observed MW by Western blot was Refer to Figures.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations