STAT3 Antibody (aa688-722)
Catalogue Number: LS-C10382-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.05% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES |
| Shipping Condition: | RT |
| Unit(s): | 200 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Bacterially expressed GST fusion protein corresponding to human STAT3 (aa 688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%). |
| Application: | ICC, IP, WB, EMSA |
Additional Text
Gene Name
STAT3
Gene ID
6774
Antigen Type
Fusion protein
Purification
Protein A purified
Short Description
STAT3 antibody LS-C10382 is an unconjugated rabbit polyclonal antibody to STAT3 (aa688-722) from human. It is reactive with human, mouse, rat and other species. Validated for GS, ICC, IP and WB.
Storage Note
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 ug/ml shows positive immunostaining for STAT 3 in A431 cells fixed with 95% ethanol, 5% acetic acid. Immunoprecipitation: 4 ug immunoprecipitates STAT 3 from 500 ug of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations