PTH / Parathyroid Hormone Antibody (aa1-38, clone A1/70)
Catalogue Number: LS-C122285-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Physical state: | Lyophilized |
| Type: | Monoclonal Primary Antibody - Unconjugated |
| Alias: | PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1 |
| Shipping Condition: | RT |
| Unit(s): | 10 ug, 100 ug |
| Host name: | Mouse |
| Clone: | A1/70 |
| Isotype: | IgG1 |
| Immunogen: | Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%). |
| Application: | IHC-P, RIA, IHC-Fr, IHC |
Additional Text
Gene ID
5741
Gene Name
PTH
Purification
Protein A purified
Short Description
Parathyroid Hormone antibody LS-C122285 is an unconjugated mouse monoclonal antibody to Parathyroid Hormone (PTH) (aa1-38) from human. It is reactive with human and monkey. Validated for IHC and RIA.
Antibody Clonality
Monoclonal
Storage Note
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
Application Notes
Suitable for use in RIA. RIA: 20 ng/ml. Immunohistochemistry: Frozen, paraffin.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations