PTH / Parathyroid Hormone Antibody (aa1-38, clone B2-82)
Catalogue Number: LS-C122288-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Physical state: | Lyophilized |
| Type: | Monoclonal Primary Antibody - Unconjugated |
| Alias: | PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1 |
| Shipping Condition: | RT |
| Unit(s): | 10 ug, 100 ug |
| Host name: | Mouse |
| Clone: | B2-82 |
| Isotype: | IgG1 |
| Immunogen: | Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%). |
| Application: | ELISA, IHC-P, RIA, IHC-Fr, IHC |
Additional Text
Gene ID
5741
Gene Name
PTH
Purification
Protein G purified
Short Description
Parathyroid Hormone antibody LS-C122288 is an unconjugated mouse monoclonal antibody to Parathyroid Hormone (PTH) (aa1-38) from human. It is reactive with human and monkey. Validated for ELISA, IHC and RIA.
Antibody Clonality
Monoclonal
Storage Note
Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
Application Notes
Suitable for use in ELISA: 1 ug/ml. Immunohistochemistry: 2 ug/ml. Frozen, paraffin. RIA: 25 ng/ml.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations