DEFB4A / BD-2 Antibody (aa4-41)
Catalogue Number: LS-C127020-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Physical state: | Lyophilized |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | DEFB4A, Beta-defensin 2, Beta-defensin 4A, DEFB-2, DEFB102, Defensin, beta 2, Defensin, beta 4, Defensin, beta 4A, DEFB4, DEFB2, HBD-2, Skin-antimicrobial peptide 1, BD-2, SAP1 |
| Shipping Condition: | RT |
| Unit(s): | 10 ug |
| Host name: | Sheep |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Gibbon, Monkey (97%); Orangutan (81%). |
| Application: | ELISA, RIA |
Additional Text
Gene Name
DEFB4A
Gene ID
1673
Purification
Protein G purified
Short Description
BD-2 antibody LS-C127020 is an unconjugated sheep polyclonal antibody to human BD-2 (DEFB4A) (aa4-41). Validated for ELISA and RIA.
Antibody Clonality
Polyclonal
Storage Note
Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.
Application Notes
Suitable for use in ELISA and RIA. ELISA: 1:5000.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations