Calcitonin Antibody
Catalogue Number: LS-C127172-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Physical state: | Lyophilized |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | Synthetic human Calcitonin, BSA-conjugated(CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP). Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Rat, Hamster (94%); Mouse, Panda, Dog, Horse (90%). |
| Application: | RIA |
Additional Text
Short Description
Calcitonin antibody LS-C127172 is an unconjugated rabbit polyclonal antibody to Calcitonin from human. It is reactive with human and monkey. Validated for RIA.
Antibody Clonality
Polyclonal
Storage Note
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
Application Notes
Suitable for use in RIA. RIA: 1:15000.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations