PTHLH / PTHRP Antibody (aa53-86)
Catalogue Number: LS-C131300-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Physical state: | Lyophilized |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | PTHLH, Osteostatin, PTHR, PTH-related protein, PTHRP, BDE2, HHM, PLP, PTH-rP |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Goat |
| Clone: | |
| Isotype: | |
| Immunogen: | Synthetic human PTHrP (aa 53-86) KLH-conjugated(KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Elephant, Panda, Bat, Dog, Pig (100%); Monkey, Sheep, Goat, Hamster, Bovine (97%); Rabbit, Horse (94%); Opossum, Turkey, Chicken (87%). |
| Application: | RIA |
Additional Text
Gene Name
PTHLH
Gene ID
5744
Short Description
PTHRP antibody LS-C131300 is an unconjugated goat polyclonal antibody to PTHRP (PTHLH) (aa53-86) from human. It is reactive with human, mouse, rat and other species. Validated for RIA.
Antibody Clonality
Polyclonal
Storage Note
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
Application Notes
Suitable for use in RIA. RIA: 1:2000.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations