PTH2 / Parathyroid Hormone 2 Antibody (aa62-100)
Catalogue Number: LS-C132511-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Physical state: | Lyophilized |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | PTH2, Parathyroid hormone 2, TIPF39, TIP39, Tuberoinfundibular 39 residues |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | Synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bovine, Pig (100%); Marmoset, Horse (97%); Elephant (94%); Mouse, Rat, Rabbit (90%). |
| Application: | ELISA, RIA |
Additional Text
Gene Name
PTH2
Gene ID
113091
Short Description
Parathyroid Hormone 2 antibody LS-C132511 is an unconjugated rabbit polyclonal antibody to Parathyroid Hormone 2 (PTH2) (aa62-100) from human. It is reactive with human, bovine, dog and other species. Validated for ELISA and RIA.
Antibody Clonality
Polyclonal
Storage Note
Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
Application Notes
Suitable for use in RIA. ELISA: 1:2000-1:4000. RIA: 1:2.000.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations