MAPK3 / ERK1 Antibody (aa372-406)

Catalogue Number: LS-C16368-LSP

Manufacturer:	LifeSpan BioSciences Inc.
Preservative:	0.05% Sodium azide
Type:	Polyclonal Primary Antibody - Unconjugated
Alias:	MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, MAP kinase 3, p44-ERK1, ERK1, PRKM3
Shipping Condition:	RT
Unit(s):	100 ug
Host name:	Rabbit
Clone:
Isotype:	IgG
Immunogen:	Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-Terminus 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
Application:	IP, WB, FA

Overview

Additional Text

Gene Name

MAPK3

Gene ID

5595

Purification

Affinity Purified

Antigen Type

Synthetic Peptide, KLH Conjugated

Short Description

ERK1 antibody LS-C16368 is an unconjugated rabbit polyclonal antibody to ERK1 (MAPK3) (aa372-406) from rat. It is reactive with mouse, rat, hamster and other species. Validated for Func, IP and WB.

Storage Note

Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.

Antibody Clonality

Polyclonal

Application Notes

Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.

Price

£790.00

-

Quantity
Unit Size

Find out about delivery