ATXN1 / SCA1 Antibody (aa164-197, clone S76-8, Atto 390)

Catalogue Number: LS-C229225-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.1% sodium azide
Type:Monoclonal Primary Antibody - Conjugated
Alias:ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1
Shipping Condition:RT
Unit(s): 100 ug
Host name: Mouse
Clone: S76-8
Isotype: IgG2b
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).
Application: IP, WB, IHC

Additional Text

Gene Name

ATXN1

Concentration

0.5 mg/ml

Gene ID

6310

Antigen Type

Synthetic Peptide

Purification

Protein G purified

Short Description

SCA1 antibody LS-C229225 is an Atto 390-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.

Storage Note

Store at -20°C.

Antibody Clonality

Monoclonal

Application Notes

The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.