ATXN1 / SCA1 Antibody (aa164-197, clone S76-8, Atto 488)
Catalogue Number: LS-C229226-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.1% sodium azide |
| Type: | Monoclonal Primary Antibody - Conjugated |
| Alias: | ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Mouse |
| Clone: | S76-8 |
| Isotype: | IgG2b |
| Immunogen: | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%). |
| Application: | IP, WB, IHC |
Additional Text
Gene Name
ATXN1
Concentration
0.5 mg/ml
Gene ID
6310
Antigen Type
Synthetic Peptide
Purification
Protein G purified
Short Description
SCA1 antibody LS-C229226 is an Atto 488-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
Storage Note
Store at -20°C.
Antibody Clonality
Monoclonal
Application Notes
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations