Catalogue Number: LS-C229238-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.1% sodium azide |
| Type: | Monoclonal Primary Antibody - Conjugated |
| Alias: | ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Mouse |
| Clone: | S76-8 |
| Isotype: | IgG2b |
| Immunogen: | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%). |
| Application: | IP, WB, IHC |
ATXN1
0.5 mg/ml
6310
Synthetic Peptide
Protein G purified
SCA1 antibody LS-C229238 is a PerCP-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
Store at -20°C.
Monoclonal
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.