EDNRB / Endothelin B Receptor Antibody
Catalogue Number: LS-C335279-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | EDNRB, ABCDS, Endothelin B receptor, Etb receptor, ET-B, Et-b receptor, Et-b-r, ET-RB, ETBR, ETRB, Etb-svr, WS4A, Endothelin receptor type B, ET-BR, ETB, HSCR, HSCR2 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EDNRB (NP_001116131.1). MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF |
| Application: | WB |
Additional Text
Gene ID
1910
Gene Name
EDNRB
Purification
Affinity Purified
Short Description
Endothelin B Receptor antibody LS-C335279 is an unconjugated rabbit polyclonal antibody to Endothelin B Receptor (EDNRB) from human. It is reactive with human and mouse. Validated for WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 48kDa/49kDa/59kDa, while the observed MW by Western blot was 50kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations