APOE / Apolipoprotein E Antibody (AP)
Catalogue Number: LS-C408190-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | APOE, AD2, Apo-E, Apolipoprotein E3, Apolipoprotein E, LDLCQ5, LPG |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human APOE (NP_000032.1). GPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEK |
| Application: | IF, IHC |
Additional Text
Gene ID
348
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Gene Name
APOE
Short Description
Apolipoprotein E antibody LS-C408190 is an AP-conjugated rabbit polyclonal antibody to Apolipoprotein E (APOE) from human. It is reactive with human and mouse. Validated for IF and IHC.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 36kDa, while the observed MW by Western blot was Refer to Figures.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations