ELAVL3 / HUC Antibody
Catalogue Number: LS-C408905-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | ELAVL3, ELAV-like protein 3, Hu antigen C, HUC, Hu-antigen C, HUCL, PLE21 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 200 ul, 50 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELAVL3 (NP_001411.2). MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTL |
| Application: | WB, IHC |
Additional Text
Gene Name
ELAVL3
Purification
Affinity Purified
Gene ID
1995
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 38kDa/39kDa, while the observed MW by Western blot was 37kDa.
Short Description
HUC antibody LS-C408905 is an unconjugated rabbit polyclonal antibody to HUC (ELAVL3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 1 publication.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations