ADCY3 / Adenylate Cyclase 3 Antibody (Cy3)
Catalogue Number: LS-C409419-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | ADCY3, AC-III, AcIII, Adenylyl cyclase 3, AC3, Adenylate cyclase type III, ATP pyrophosphate-lyase 3, Adenylate cyclase 3, Adenylate cyclase type 3, Adenylyl cyclase, type III, KIAA0511 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLV |
| Application: | WB, IHC |
Additional Text
Purification
Affinity Purified
Gene ID
109
Gene Name
ADCY3
Short Description
Adenylate Cyclase 3 antibody LS-C409419 is a Cy3-conjugated rabbit polyclonal antibody to Adenylate Cyclase 3 (ADCY3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 82kDa/128kDa, while the observed MW by Western blot was 150kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations