FZD10 / Frizzled 10 Antibody (C-Terminus, FITC)
Catalogue Number: LS-C441875-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | Synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%); Dog, Horse, Mouse, Bovine (92%). |
| Application: | IF |
Additional Text
Concentration
0.5 mg/ml
Gene Name
FZD10
Gene ID
11211
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Protein: Target Region
C-terminus
Short Description
Frizzled 10 antibody LS-C441875 is an FITC-conjugated rabbit polyclonal antibody to Frizzled 10 (FZD10) (C-Terminus) from human. It is reactive with human and pig. Validated for IF.
Antibody Clonality
Polyclonal
Storage Note
Short term: store at 4°C. Long term: add glycerol to 40-50%, aliquot to avoid freeze-thaw cycles, and store at -20°C. Protect from light.
Application Notes
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations