MSI1 / Musashi 1 Antibody
Catalogue Number: LS-C497946-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | MSI1, Musashi homolog 1 (Drosophila), Musashi RNA-binding protein 1, Musashi (Drosophila) homolog 1, Musashi1, Musashi 1, Musashi-1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSI1 (NP_002433.1). METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRA |
| Application: | WB |
Additional Text
Gene ID
4440
Purification
Affinity Purified
Gene Name
MSI1
Short Description
Musashi 1 antibody LS-C497946 is an unconjugated rabbit polyclonal antibody to human Musashi 1 (MSI1). Validated for WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 39kDa, while the observed MW by Western blot was 47kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations