MSI1 / Musashi 1 Antibody
Catalogue Number: LS-C662231-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Shelf Life: | 12 months |
| Preservative: | 0.05 mg Sodium azide |
| Physical state: | Lyophilized |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | MSI1, Musashi homolog 1 (Drosophila), Musashi RNA-binding protein 1, Musashi (Drosophila) homolog 1, Musashi1, Musashi 1, Musashi-1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug, 10 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-Terminus of human Musashi 1/Msi1 (21-54 aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences. |
| Application: | IHC-P, WB, IHC |
Additional Text
Gene ID
4440
Purification
Affinity Purified
Gene Name
MSI1
Short Description
Musashi 1 antibody LS-C662231 is an unconjugated rabbit polyclonal antibody to human Musashi 1 (MSI1). Validated for IHC and WB.
Antibody Clonality
Polyclonal
Storage Note
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations