CD4 Antibody
Catalogue Number: LS-C746731-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | CD4, CD4 antigen, CD4 receptor, CD4mut, CD4 antigen (p55), CD4 molecule |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD4 (NP_000607.1). ALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALI |
| Application: | IF, IHC |
Additional Text
Gene ID
920
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Gene Name
CD4
Short Description
CD4 antibody LS-C746731 is an unconjugated rabbit polyclonal antibody to CD4 from human. It is reactive with human, mouse and rat. Validated for IF and IHC.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 51kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations