HDAC5 Antibody
Catalogue Number: LS-C746747-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | HDAC5, Antigen NY-CO-9, Histone deacetylase 5, NY-CO-9, HD5, KIAA0600 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human HDAC5 (NP_005465.2). EETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLAT |
| Application: | IF, WB, IHC |
Additional Text
Gene Name
HDAC5
Gene ID
10014
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Short Description
HDAC5 antibody LS-C746747 is an unconjugated rabbit polyclonal antibody to HDAC5 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 112kDa/121kDa/122kDa, while the observed MW by Western blot was 122kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations